xtuition

X000008610

General
NESGSsR10
Spine StatusNMR and X-Ray structures
Length121 aa
Mass13.99 kD
ext22460
pI6.75
Name
Orf c02003 protein (Hypothetical protein)
P NumberP000008627
Database References NCBI UniProt
PFAM PF05942
PDB Structures 2JPU (NMR) 2Q00 (Xray)
Purification
Date Purified2007-03-19
Setup Date2007-03-23
ExpMolecularWeight15103.8
Volume450.0 ┬ÁL
Concentration8.2 mg/mL
Sequence
Gene
OrganismSulfolobus solfataricus
GenusSulfolobus
Speciessolfataricus
Strain
Sequence
MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNS