xtuition

X000008628

General
NESGPR113
Spine Statuscrystal hits
Length184 aa
Mass20.79 kD
ext8940
pI5.86
Name
Probable 16S rRNA-processing protein rimM
P NumberP000008643
Database References NCBI UniProt
PFAM PF01782
PDB Structures 3A1P (Best Match)
Purification
Date Purified2007-03-20
Setup Date2007-03-29
ExpMolecularWeight21997.8
Volume450.0 ┬ÁL
Concentration8.6 mg/mL
Sequence
Gene
OrganismHelicobacter pylori
GenusHelicobacter
Speciespylori
Strain
Sequence
MVSMLLVGRIGKSVGLNGGLRLHLESDFPECLKKGVKVSVAPLNAFSCVSSFKEYIIHSYEHAKNLLFLETIQTPEKAKELTNLGLFMSEAESKKLCVLKEGEFFYCDLVGLSVVEENEILGKVIEIQRISQTDYFLVETTLNLVEKGLAKIFLIPYRDFYIQEILLQDKKITTHNAKTLLENS