xtuition

X000008857

General
NESGVfR98
Spine StatusX-Ray structure
Length111 aa
Mass12.72 kD
ext20970
pI6.03
Name
Tellurite resistance protein TehB
P NumberP000008872
Database References NCBI UniProt
PFAM PF09313
PDB Structures 3DL3 (Xray)
Purification
Date Purified2007-05-16
Setup Date2007-05-25
ExpMolecularWeight13929.9
Volume450.0 ┬ÁL
Concentration11.1 mg/mL
Sequence
Gene
OrganismVibrio fischeri
GenusVibrio
Speciesfischeri
Strain
Sequence
MSHLRIPKNWTIQRSTPFFTKDNVPEALLTHHNTAVDVFGQICVMEGVVTYYGFANSEATEPEIKVVINAGQFATSPPQYWHRIELSDDAQFNINFWSDQDKSGKKMFNTK