xtuition

X000009046

General
NESGCtR17A
Spine StatusHSQC collected and crystal hits
Length200 aa
Mass22.28 kD
ext26930
pI9.02
Name
Lipoprotein, putative
P NumberP000009062
Database References NCBI UniProt
PFAM PF04832
PDB Structures 4AYZ (Best Match)
Purification
Date Purified2007-06-25
Setup Date2007-07-13
ExpMolecularWeight23574.8
Volume450.0 ┬ÁL
Concentration10.0 mg/mL
Sequence
Gene
OrganismChlorobium tepidum
GenusChlorobaculum
Speciestepidum
Strain
Sequence
MSVLGKREAAEPPYELLKHDGAFEVRRYGPMVIAETILDEKSYSAASGKGFNRLAGYIFGKNRSKTSISMTAPVLQERSSEKISMTAPVLQQPQKGGWSMAFVLPEGFTLQSAPEPLDPEVKLRELPPSTIAVVTFSGLHSAANLEKYSRQLQAWLKKQGYRALSEPKLASYDPPWTIPFLRRNEVQIRIEPDHGESGKE