xtuition

X000009233

General
NESGPsR214
Spine Statuscrystal hits
Length154 aa
Mass17.54 kD
ext12490
pI9.52
Name
Hypothetical protein
P NumberP000009278
Database References NCBI UniProt
PFAM PF07813
PDB Structures 3OEO (Best Match)
Purification
Date Purified2007-03-06
Setup Date2007-09-14
ExpMolecularWeight19076.1
Volume450.0 ┬ÁL
Concentration11.8 mg/mL
Sequence
Gene
OrganismPseudomonas syringae
GenusPseudomonas
Speciessyringae
Strain
Sequence
MRKTLIALMFATALPAIAMAAPPAPPAGAPDADAPGMHMQRGDRGPGMHRGPGPLKELDLTREQRQQIDRLMREQMHERREITQNYLEKMPAADQKAMRDEIEAKRSKTDSEVRALLKPDQQKQFDEIKKKEDERRAEWAEFKAWKAAKTAKAQ