![]() | StR222 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 161 aa |
Mass | 18.23 kD |
ext | 2980 |
pI | 9.66 |
Name | Periplasmic protein related to spheroblast formation |
P Number | P000009349 |
Database References | UniProt |
PFAM | PF07813 |
PDB Structures | 3OEO (Best Match) |
Date Purified | 2007-01-26 |
---|---|
Setup Date | 2007-10-11 |
ExpMolecularWeight | 19908.7 |
Volume | 450.0 µL |
Concentration | 15.3 mg/mL |
Gene | |
---|---|
Organism | Salmonella typhimurium |
Genus | Salmonella |
Species | typhimurium |
Strain | |
Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |