xtuition

X000009353

General
NESGHR3153
Spine StatusHSQC collected and crystal hits
Length340 aa
Mass38.04 kD
ext18910
pI8.74
Name
RecName: Full=DnaJ homolog subfamily B member 1;AltName: Full=Heat shock 40 kDa protein 1; Short=Heat shock protein 40;AltName: Full=HSP40;AltName: Full=DnaJ protein homolog 1;AltName: Full=HDJ-1;
P NumberP000009366
Database References NCBI UniProt
PFAM PF00226
PDB Structures 3AGZ (Best Match)
Purification
Date Purified2007-09-25
Setup Date2007-10-12
ExpMolecularWeight39258.9
Volume450.0 ┬ÁL
Concentration0.0 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI