xtuition

X000009358

General
NESGHR3159
Spine StatusHSQC collected and crystal hits
Length160 aa
Mass17.82 kD
ext15470
pI4.33
Name
RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118;
P NumberP000009369
Database References NCBI UniProt
PFAM PF01248
PDB Structures 2KG4 (Best Match)
Purification
Date Purified2007-09-25
Setup Date2007-10-15
ExpMolecularWeight19070.6
Volume450.0 ┬ÁL
Concentration0.0 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER