xtuition

X000009640

General
NESGEfR150
Spine StatusX-Ray structure
Length214 aa
Mass24.14 kD
ext27390
pI4.53
Name
Thiamin pyrophosphokinase family protein
P NumberP000009660
Database References NCBI UniProt
PFAM PF04263
PDB Structures 3MEL (Xray)
Purification
Date Purified2008-01-16
Setup Date2008-01-24
ExpMolecularWeight25350.7
Volume450.0 ┬ÁL
Concentration8.9 mg/mL
Sequence
Gene
OrganismEnterococcus faecalis
GenusEnterococcus
Speciesfaecalis
Strain
Sequence
MSRVLLVAGGNPSDWPTIEPATYDYFVGIDRGCLHLLEADLPLQLAVGDFDSLSREEYHFVQETTETLIQAPAEKDDTDTQLALQEALQRFPQAEMTIIGATGGRIDHLLANLWLPFEPRFQGVLRQIRLCDRQNSIQYYAPGSYIVPKEPDKEYLAYCCLTPVENLTLRRSKYLLTNQDVPYPTSYASNEFIEEAAAFSFDAGMIAVIQSKDK