xtuition

X000009696

General
NESGLpR108
Spine StatusX-Ray structure
Length276 aa
Mass30.42 kD
ext57870
pI6.33
Name
Lipase/esterase (Putative)
P NumberP000009713
Database References NCBI UniProt
PFAM PF07859
PDB Structures 3D3N (Xray)
Purification
Date Purified2008-01-30
Setup Date2008-02-08
ExpMolecularWeight31764.6
Volume450.0 ┬ÁL
Concentration6.1 mg/mL
Sequence
Gene
OrganismLactobacillus plantarum
GenusLactobacillus
Speciesplantarum
Strain
Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGNY