xtuition

X000009781

General
NESGBcR215
Spine StatusX-Ray structure
Length199 aa
Mass21.71 kD
ext11460
pI8.49
Name
Dipicolinate synthase, B chain
P NumberP000009803
Database References NCBI UniProt
PFAM PF02441
PDB Structures 3MCU (Xray)
Purification
Date Purified2008-02-26
Setup Date2008-03-14
ExpMolecularWeight23286.1
Volume450.0 ┬ÁL
Concentration7.4 mg/mL
Sequence
Gene
OrganismBacillus cereus
GenusBacillus
Speciescereus
Strain
Sequence
MSLKGKRIGFGFTGSHCTYEEVMPHLEKLIAEGAEVRPVVSYTVQSTNTRFGEGAEWIKKIEEITGFKAINSIVGAEPLGPKIPLDCMVIAPLTGNSMSKFANAMTDSPVLMAAKATLRNGKPVVLAVSTNDALGLNGVNLMRLMATKNIYFVPFGQDAPEKKPNSMVARMELLEDTVLEALQGKQLQPVVVEKFRYMN