xtuition

X000009796

General
NESGCfR4
Spine StatusHSQC collected and crystal hits
Length140 aa
Mass15.48 kD
ext5960
pI5.68
Name
Putative uncharacterized protein
P NumberP000009863
Database References NCBI UniProt
PFAM PF09391
PDB Structures
Purification
Date Purified2008-03-10
Setup Date2008-03-24
ExpMolecularWeight16780.4
Volume450.0 ┬ÁL
Concentration10.0 mg/mL
Sequence
Gene
OrganismClostridium difficile
GenusClostridium
Speciesdifficile
Strain
Sequence
MENKNSKCVMVIDENLPMGIISNTAAIMGITLGKHAPETVGPDVIDKTGNSHLGIIDIPVPILKGNKEIIKDLRKKLYTLEFNDLTVVDFSDVAQSCNLYEEFTQKIASVPEDELQYFGIAIYGNKKKVNKLTGSMPLLR