xtuition

X000009817

General
NESGCfR19
Spine Statusaggregation screening
Length339 aa
Mass37.17 kD
ext18910
pI5.42
Name
Putative molybdopterin biosynthesis protein
P NumberP000009941
Database References NCBI UniProt
PFAM PF00994
PDB Structures 1UZ5 (Best Match)
Purification
Date Purified2008-04-16
Setup Date2008-04-24
ExpMolecularWeight38658.3
Volume450.0 ┬ÁL
Concentration7.4 mg/mL
Sequence
Gene
OrganismClostridium difficile
GenusClostridium
Speciesdifficile
Strain
Sequence
MKLIKTIDAVGQVLCHDITQIIPGEFKGRKFKKGHIVKEEDIPVLLSLGKDNLYVWEKSEGMVHENEGALFLKELTAGENLDFSEIKEGKIDFIAACDGLLKIDVDALFDLNCVGEIMMATLHNNFIVNKGLKVAGTRVIPLVIDEKKLEDAKKVVGNRKIVNVVPFKPKKVGIVTTGNEVFYSRIVDKFGPVIEEKVKGFGCEVIGQTICPDDKEIIKSAIKEFISQGAELICCTGGMSVDPDDVTPTAIKETGADLVTYGSPILPGAMFLLAYYGEVPIMGIPGCAMYHKTTVFDIVLSRVLIDEKLDKYDIARYGHGGLCMNCDVCTYPACNFAKI