xtuition

X000010023

General
NESGBoR214A
Spine StatusX-Ray structure
Length136 aa
Mass14.80 kD
ext15470
pI7.03
Name
Putative uncharacterized protein
P NumberP000010049
Database References NCBI UniProt
PFAM PF03061
PDB Structures 3E29 (Xray)
Purification
Date Purified2008-05-19
Setup Date2008-05-30
ExpMolecularWeight16142.3
Volume450.0 ┬ÁL
Concentration6.6 mg/mL
Sequence
Gene
OrganismBordetella bronchiseptica
GenusBordetella
Speciesbronchiseptica
Strain
Sequence
MSSTALEMASRFVNRSPFNRWLGMSVLEAGEQGIVLGIKWREELISSPEIRSTHGGILATLVDAAGDYAVALKTGHPVPTMDMHVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDMDGNLVASGRALYLIRAP