xtuition

X000010115

General
NESGStR152
Spine Statuscrystal hits
Length335 aa
Mass37.88 kD
ext28880
pI4.91
Name
Nucleoid-associated protein ndpA
P NumberP000010142
Database References NCBI UniProt
PFAM PF04245
PDB Structures
Purification
Date Purified2008-06-16
Setup Date2008-06-27
ExpMolecularWeight39392.7
Volume450.0 ┬ÁL
Concentration4.7 mg/mL
Sequence
Gene
OrganismSalmonella typhimurium
GenusSalmonella
Speciestyphimurium
Strain
Sequence
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTTTVVEMVAELHRVYSAKNKAYGLFNEESELAQALRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGIVLFCHYRYLAVEYLLVTVLNNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPQSTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELESLSKELSGVSEVSFSEFTAEKGYELEESFPADRSTLRQLTKYAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK