xtuition

X000010343

General
NESGDhR8C
Spine StatusNMR and X-Ray structures
Length62 aa
Mass6.79 kD
ext1490
pI5.16
Name
Putative uncharacterized protein
P NumberP000010389
Database References NCBI UniProt
PFAM PF07873
PDB Structures 2KS0 (NMR) 2KYI (NMR) 3IPF (Xray)
Purification
Date Purified2008-09-02
Setup Date2008-09-12
ExpMolecularWeight7856.9
Volume450.0 ┬ÁL
Concentration8.0 mg/mL
Sequence
Gene
OrganismDesulfitobacterium hafniense
GenusDesulfitobacterium
Specieshafniense
Strain
Sequence
DNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYP