xtuition

X000010391

General
NESGLpR140A
Spine StatusX-Ray structure
Length112 aa
Mass12.17 kD
ext19940
pI6.06
Name
Putative uncharacterized protein lp_1913
P NumberP000010453
Database References UniProt
PFAM PF00581
PDB Structures 3I3U (Xray)
Purification
Date Purified2008-09-09
Setup Date2008-09-19
ExpMolecularWeight13375.7
Volume450.0 ┬ÁL
Concentration9.1 mg/mL
Sequence
Gene
OrganismLactobacillus plantarum
GenusLactobacillus
Speciesplantarum
Strain
Sequence
MNDKKIELLTTYLSLYIDHHTVLADMQNATGKYVVLDVRNAPAQVKKDQIKGAIAMPAKDLATRIGELDPAKTYVVYDWTGGTTLGKTALLVLLSAGFEAYELAGALEGWKG