xtuition

X000011087

General
NESGHR6187A
Spine Statuscrystal hits
Length340 aa
Mass38.98 kD
ext35410
pI8.61
Name
RecName: Full=mRNA-capping enzyme;AltName: Full=HCE;AltName: Full=HCAP1;Includes: RecName: Full=Polynucleotide 5-triphosphatase; EC=3.1.3.33; AltName: Full=mRNA 5-triphosphatase; Short=TPase;Includes: RecName: Full=mRNA guanylyltransferase; EC=2.7.7.50; AltName: Full=GTP--RNA guanylyltransferase; Short=GTase;
P NumberP000011274
Database References NCBI UniProt
PFAM PF01331
PDB Structures 3S24 (Best Match)
Purification
Date Purified2009-06-01
Setup Date2009-06-18
ExpMolecularWeight40711.4
Volume450.0 ┬ÁL
Concentration8.8 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
LGAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTA