xtuition

X000011094

General
NESGEwR203
Spine Statuscrystal hits
Length311 aa
Mass35.41 kD
ext33810
pI5.65
Name
Putative dTDP-glucose 4,6-dehydratase
P NumberP000011288
Database References NCBI UniProt
PFAM PF01370
PDB Structures 3GGR (Best Match)
Purification
Date Purified2009-06-08
Setup Date2009-06-19
ExpMolecularWeight36804.1
Volume450.0 ┬ÁL
Concentration6.1 mg/mL
Sequence
Gene
OrganismErwinia carotovora
GenusPectobacterium
Speciescarotovorum
Strain
Sequence
MHIAILGCTSQIAKDLIRSIYVYSQHDLILFGRTPQQTQSWLAENGITSRCSVNQYEEYPNIDHDVVINFVGIGDPSKAAAMGGSIFDITLHYDELVLNELKKYPDRRYLFLSSGAAYGSSFLEPADADTPSTININNLLPQEYYSVAKLHAECRHRSLKEYAIVDLRVFNVFSRTQDLEARFFITDIVRSIHSGTELITSSDMIYRDFMHPKDFYQLVERVLNAPPMNISLDCYSRQPVDKTTLLDEMKKTFGLSYRVKESNMSINATGIKPCYYSKNKRAAEFGYLPEYSSLETIIEETNAILGLQKTV