xtuition

X000011100

General
NESGSgR112
Spine StatusX-Ray structure
Length289 aa
Mass33.03 kD
ext49390
pI5.27
Name
Slr1438 protein
P NumberP000011294
Database References NCBI UniProt
PFAM PF01263
PDB Structures 3K25 (Xray)
Purification
Date Purified2009-06-10
Setup Date2009-06-19
ExpMolecularWeight34187.6
Volume450.0 ┬ÁL
Concentration8.6 mg/mL
Sequence
Gene
OrganismSynechocystis sp.
GenusSynechocystis
Speciessp. PCC 6803
Strain
Sequence
MYNISFTPDRPLTYHLEDDQSLARLSLVPGRGGLVTEWTVQGQPILYFDRERFQDPSLSVRGGIPILFPICGNLPQDQFNHAGKSYRLKQHGFARDLPWEVIGQQTQDNARLDLRLSHNDATLEAFPFAFELVFSYQLQGHSLRIEQRIANLGDQRMPFSLGFHPYFFCREKLGITLAIPANDYLDQKTGDCHGYDGQLNLTSPELDLAFTQISQPRAHFIDPDRNLKIEVSFSELYQTLVLWTVAGKDYLCLEPWSGPRNALNSGEQLAWVEPYSSRSAWVNFQVSTE