xtuition

X000011115

General
NESGSgR46
Spine StatusNMR structure and crystal hits
Length112 aa
Mass12.64 kD
ext28990
pI5.00
Name
Probable 30S ribosomal protein PSRP-3 (Ycf65-like protein)
P NumberP000011309
Database References NCBI UniProt
PFAM PF04839
PDB Structures 2KT9 (NMR)
Purification
Date Purified2009-06-16
Setup Date2009-06-30
ExpMolecularWeight13216.5
Volume450.0 ┬ÁL
Concentration11.1 mg/mL
Sequence
Gene
OrganismSynechocystis sp.
GenusSynechocystis
Speciessp. PCC 6803
Strain
Sequence
MTTAEAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSN