xtuition

X000011178

General
NESGHR2930
Spine StatusX-Ray structure
Length175 aa
Mass20.13 kD
ext30940
pI5.32
Name
RecName: Full=Bcl-2-related protein A1;AltName: Full=Protein BFL-1;AltName: Full=Hemopoietic-specific early response protein;AltName: Full=Protein GRS;
P NumberP000011395
Database References NCBI UniProt
PFAM PF00452
PDB Structures 3I1H (Xray) 3MQP (Xray)
Purification
Date Purified2009-07-14
Setup Date2009-07-23
ExpMolecularWeight18604.0
Volume450.0 ┬ÁL
Concentration3.7 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC