xtuition

X000011389

General
NESGSaR39B
Spine Statusgood HSQC collected and crystal hits
Length114 aa
Mass12.48 kD
ext8940
pI6.75
Name
Hypothetical protein gbs0903
P NumberP000011637
Database References NCBI UniProt
PFAM PF07949
PDB Structures 4QDY (Best Match)
Purification
Date Purified2009-09-14
Setup Date2009-09-24
ExpMolecularWeight12856.8
Volume450.0 ┬ÁL
Concentration10.0 mg/mL
Sequence
Gene
OrganismStreptococcus agalactiae
GenusStreptococcus
Speciesagalactiae
Strain
Sequence
TATSMNHQDNSKIAGASETYTHTLTDVPIDIKYDSDDYFISGYSYGADVYMSSVNRVKLDSEINEDTRKFKVVADLTNMKPGTHKVPLKVVNLPSGVNATVSPTTITVTMGKKK