xtuition

X000011398

General
NESGHR5531C
Spine StatusX-Ray structure
Length178 aa
Mass21.51 kD
ext22920
pI6.30
Name
RecName: Full=Phosphatidylinositol 3-kinase regulatory subunit beta;AltName: Full=PI3-kinase p85 subunit beta;AltName: Full=PtdIns-3-kinase p85-beta;
P NumberP000011649
Database References UniProt
PFAM PF00017
PDB Structures 3MTT (Xray)
Purification
Date Purified0001-01-01
Setup Date2009-10-02
ExpMolecularWeight18.0
Volume450.0 ┬ÁL
Concentration15.0 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
IVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMED