xtuition

X000011566

General
NESGPfR165A
Spine StatusHSQC collected and crystal hits
Length148 aa
Mass17.01 kD
ext18450
pI5.76
Name
Hypothetical protein PF0091
P NumberP000011889
Database References NCBI UniProt
PFAM PF05763
PDB Structures
Purification
Date Purified2009-11-03
Setup Date2009-11-12
ExpMolecularWeight18830.1
Volume450.0 ┬ÁL
Concentration8.7 mg/mL
Sequence
Gene
OrganismPyrococcus furiosus
GenusPyrococcus
Speciesfuriosus
Strain
Sequence
KEEKRALKLPIPHNILILNRNSALELLRALKEVPKLIITRIPPDEWPDVAYTEYIWLSRVEGPNSVSPTALHVIIERAKTFLDENSGGVIYVDGIEYIMLYEEFKSVAKFLLTLKDIAVVKEGHLILHVDPKTLEDHQMAVLEREFVK