xtuition

X000011603

General
NESGPfR165
Spine StatusHSQC collected and crystal hits
Length273 aa
Mass30.50 kD
ext26930
pI6.34
Name
Hypothetical protein PF0091
P NumberP000011920
Database References NCBI UniProt
PFAM PF05763
PDB Structures
Purification
Date Purified2009-11-09
Setup Date2009-11-20
ExpMolecularWeight20313.9
Volume450.0 ┬ÁL
Concentration8.3 mg/mL
Sequence
Gene
OrganismPyrococcus furiosus
GenusPyrococcus
Speciesfuriosus
Strain
Sequence
MEKLANILAGLILIILGMLGILRAIMEYNLHKGPTKKLALTLAISFVFFGILGGIGALLTVINESAWAITAISVILGYLIIVSSVINVLSKLREKKSEEKPKEEKRALKLPIPHNILILNRNSALELLRALKEVPKLIITRIPPDEWPDVAYTEYIWLSRVEGPNSVSPTALHVIIERAKTFLDENSGGVIYVDGIEYIMLYEEFKSVAKFLLTLKDIAVVKEGHLILHVDPKTLEDHQMAVLEREFVKINVEETIEKIRGPTLFGALIEEKG