xtuition

X000011610

General
NESGHR4604D
Spine StatusX-Ray structure
Length81 aa
Mass9.62 kD
ext11000
pI6.69
Name
RecName: Full=Tripartite motif-containing protein 37;AltName: Full=Mulibrey nanism protein;
P NumberP000011924
Database References NCBI UniProt
PFAM PF00643
PDB Structures 3LRQ (Xray)
Purification
Date Purified2009-11-11
Setup Date2009-11-23
ExpMolecularWeight12035.3
Volume450.0 ┬ÁL
Concentration6.6 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL