xtuition

X000011687

General
NESGHR4730F
Spine StatusHSQC collected and crystal hits
Length105 aa
Mass11.45 kD
ext16960
pI5.12
Name
RecName: Full=RNA-binding protein 39;AltName: Full=RNA-binding motif protein 39;AltName: Full=RNA-binding region-containing protein 2;AltName: Full=Hepatocellular carcinoma protein 1;AltName: Full=Splicing factor HCC1;
P NumberP000012006
Database References NCBI UniProt
PFAM PF00076
PDB Structures 4OZ1 (Best Match)
Purification
Date Purified2009-12-09
Setup Date2009-12-22
ExpMolecularWeight13996.8
Volume450.0 ┬ÁL
Concentration7.4 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
AAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDS