xtuition

X000005022

General
NESGSoR21
Spine Statusgood HSQC collected and crystal hits
Length153 aa
Mass17.75 kD
ext32430
pI5.44
Name
NA
P NumberP000005022
Database References NCBI UniProt
PFAM PF01878
PDB Structures 2EVE (Best Match)
Purification
Date Purified2005-01-25
Setup Date2005-05-27
ExpMolecularWeight19309.6
Volume400.0 ┬ÁL
Concentration7.9 mg/mL
Sequence
Gene
OrganismShewanella oneidensis
GenusShewanella
Speciesoneidensis
Strain
Sequence
MNYWLMKSEPDEFSIEDLKARPNQTEPWFGIRNYQARNYMRDAMQIGDKVFFYHSSCKVPGIVGIAEVVTNAYPDSTAFDPESTYFDPKSDPSNPRWLRVDIRFVEQFKEIIPLSLIKSLPQLADMYLVSKGSRLSIQPVTAEQWQAVLMLSR