xtuition

X000005260

General
NESGNR1
Spine StatusX-Ray structure
Length129 aa
Mass15.03 kD
ext18910
pI8.81
Name
Hypothetical protein FN1578
P NumberP000005376
Database References NCBI UniProt
PFAM PF00636
PDB Structures 2GSL (Xray)
Purification
Date Purified2005-06-23
Setup Date2005-07-01
ExpMolecularWeight16233.1
Volume400.0 ┬ÁL
Concentration6.5 mg/mL
Sequence
Gene
OrganismFusobacterium nucleatum
GenusFusobacterium
Speciesnucleatum
Strain
Sequence
MDNVDFSKDIRDYSGLELAFLGDAIWELEIRKYYLQFGYNIPTLNKYVKAKVNAKYQSLIYKKIINDLDEEFKVIGKRAKNSNIKTFPRSCTVMEYKEATALEAIIGAMYLLKKEEEIKKIINIVIKGE