xtuition

X000005264

General
NESGSaR18
Spine StatusHSQC collected and crystal hits
Length276 aa
Mass31.12 kD
ext17420
pI5.54
Name
UPF0085 protein SAG1671
P NumberP000005140
Database References NCBI UniProt
PFAM PF03618
PDB Structures
Purification
Date Purified2005-05-25
Setup Date2005-07-01
ExpMolecularWeight32466.9
Volume400.0 ┬ÁL
Concentration5.6 mg/mL
Sequence
Gene
OrganismStreptococcus agalactiae
GenusStreptococcus
Speciesagalactiae
Strain
Sequence
MEDQLTIFIISDSLGETAKAIAKACLSQFPGHDDWHFQRFSYINSQERLEQVFEEASQKTVFMMFSLVDVALASYAQKRCESEHYAYVDLLTNVIQGISRISGIDPLGEPGILRRLDNDYFKRVESIEFAVKYDDGRDPRGILQADLVIIGISRTSKTPLSMFLADKNIKVINIPLVPEVPVPKELRMIDSRRIIGLTNSVDHLNQVRKVRLKSLGLSSTANYASLERILEETRYAEEVMKNLGCPIINVSDKAIEETATIILEILKTNGQVAKNL