xtuition

X000005298

General
NESGHR41
Spine StatusNMR and X-Ray structures
Length167 aa
Mass19.46 kD
ext41940
pI6.91
Name
RecName: Full=Ufm1-conjugating enzyme 1;AltName: Full=Ubiquitin-fold modifier-conjugating enzyme 1;
P NumberP000005392
Database References NCBI UniProt
PFAM PF08694
PDB Structures 2K07 (NMR) 3EVX (Xray)
Purification
Date Purified2005-06-30
Setup Date2005-07-08
ExpMolecularWeight20663.9
Volume400.0 ┬ÁL
Concentration9.8 mg/mL
Sequence
Gene
OrganismHomo sapiens
GenusHomo
Speciessapiens
Strain
Sequence
MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ