xtuition

X000005301

General
NESGZR18
Spine StatusNMR and X-Ray structures
Length83 aa
Mass9.41 kD
ext6990
pI4.65
Name
Hypothetical protein
P NumberP000005395
Database References NCBI UniProt
PFAM PF08712
PDB Structures 1PQX (NMR) 2FFM (Xray) 2M6Q (NMR) 2M8W (NMR)
Purification
Date Purified2005-06-30
Setup Date2005-07-08
ExpMolecularWeight10659.2
Volume400.0 ┬ÁL
Concentration9.7 mg/mL
Sequence
Gene
OrganismStaphylococcus aureus
GenusStaphylococcus
Speciesaureus
Strain
Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE