xtuition

X000005307

General
NESGET52
Spine StatusHSQC collected
Length123 aa
Mass12.70 kD
ext2980
pI8.76
Name
Hypothetical protein ybaV precursor
P NumberP000005184
Database References NCBI UniProt
PFAM PF12836
PDB Structures 2EDU (Best Match)
Purification
Date Purified2005-05-31
Setup Date2005-07-11
ExpMolecularWeight12891.1
Volume400.0 ┬ÁL
Concentration9.7 mg/mL
Sequence
Gene
OrganismEscherichia coli
GenusEscherichia
Speciescoli
Strain
Sequence
MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQSKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAVLTL