xtuition

X000005314

General
NESGVcR20
Spine StatusX-Ray structure
Length342 aa
Mass39.09 kD
ext25440
pI6.31
Name
Succinylglutamate desuccinylase (EC 3.1.-.-)
P NumberP000005251
Database References NCBI UniProt
PFAM PF04952
PDB Structures 2G9D (Xray)
Purification
Date Purified2005-06-15
Setup Date2005-07-11
ExpMolecularWeight40720.0
Volume400.0 ┬ÁL
Concentration1.2 mg/mL
Sequence
Gene
OrganismVibrio cholerae
GenusVibrio
Speciescholerae
Strain
Sequence
MTKSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD