xtuition

X000005552

General
NESGBhR2
Spine StatusNMR structure and crystal hits
Length94 aa
Mass10.99 kD
ext26930
pI9.81
Name
UPF0213 protein BH0048
P NumberP000005663
Database References NCBI UniProt
PFAM PF01541
PDB Structures 1ZG2 (NMR)
Purification
Date Purified2005-07-28
Setup Date2005-08-12
ExpMolecularWeight12528.0
Volume400.0 ┬ÁL
Concentration6.4 mg/mL
Sequence
Gene
OrganismBacillus halodurans
GenusBacillus
Specieshalodurans
Strain
Sequence
MNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKEQLVSLKGGPYENTTKLSTT