xtuition

X000005599

General
NESGSR329
Spine StatusHSQC collected and crystal hits
Length74 aa
Mass8.80 kD
ext14440
pI5.88
Name
YfhS protein
P NumberP000005665
Database References NCBI UniProt
PFAM
PDB Structures
Purification
Date Purified2005-08-09
Setup Date2005-08-19
ExpMolecularWeight9861.8
Volume400.0 ┬ÁL
Concentration5.5 mg/mL
Sequence
Gene
OrganismBacillus subtilis
GenusBacillus
Speciessubtilis
Strain
Sequence
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD