xtuition

X000005634

General
NESGSR352
Spine StatusX-Ray structure
Length118 aa
Mass13.98 kD
ext19940
pI6.03
Name
Phage-like element PBSX protein xkdH
P NumberP000005695
Database References NCBI UniProt
PFAM PF12206
PDB Structures 3F3B (Xray)
Purification
Date Purified2005-08-18
Setup Date2005-08-26
ExpMolecularWeight15043.7
Volume400.0 ┬ÁL
Concentration7.6 mg/mL
Sequence
Gene
OrganismBacillus subtilis
GenusBacillus
Speciessubtilis
Strain
Sequence
MSYRQMLIHRCDIYHEAAQAPSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLIQEEPDQTVYHSFLVHFPLSADIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDESL