xtuition

X000005707

General
NESGSR398
Spine StatusHSQC collected and crystal hits
Length121 aa
Mass13.77 kD
ext7450
pI5.24
Name
YorW protein
P NumberP000005741
Database References NCBI UniProt
PFAM
PDB Structures
Purification
Date Purified2005-08-29
Setup Date2005-09-09
ExpMolecularWeight14836.7
Volume400.0 ┬ÁL
Concentration5.4 mg/mL
Sequence
Gene
OrganismBacillus subtilis
GenusBacillus
Speciessubtilis
Strain
Sequence
MLTDQEKIDLVNALDFVVIEPHTQSIYVHNDEKTNGVLAKVLHTISVDEYIESFKKGSLIDIFPAAMQEAGAEGFKDGQFVIMPKKFYVDQCYAMSKEIERLTNLNNLHNIKPNTYQGLIH