xtuition

X000006885

General
NESGOR8C
Spine StatusNMR and X-Ray structures
Length131 aa
Mass14.75 kD
ext17990
pI5.17
Name
Influenza A virus Non-structural protein 1
P NumberP000006903
Database References UniProt
PFAM PF00600
PDB Structures 2KKZ (NMR) 2RHK (Xray)
Purification
Date Purified0001-01-01
Setup Date2006-05-05
ExpMolecularWeight0.0
Volume400.0 ┬ÁL
Concentration0.0 mg/mL
Sequence
Gene
OrganismOther
GenusUnknown
Speciesunknown
Strain
Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGSSNENGRPPLT