xtuition

X000008146

General
NESGSvR196
Spine StatusX-Ray structure
Length229 aa
Mass23.99 kD
ext12950
pI5.38
Name
Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3endonuclease)(Deoxyribonuclease V) (DNase V)
P NumberP000008165
Database References NCBI UniProt
PFAM PF04493
PDB Structures 3GOC (Xray)
Purification
Date Purified2006-12-19
Setup Date2007-01-12
ExpMolecularWeight25100.1
Volume450.0 ┬ÁL
Concentration8047.0 mg/mL
Sequence
Gene
OrganismStreptomyces avermitilis
GenusStreptomyces
Speciesavermitilis
Strain
Sequence
MTTVRIPAGWPATEEEARAVQDELRGRVILDEPGPPPGTGRVTGVDVAYDDERDVVVAAAVVLDAATLDVVAEATAVGEVSFPYVPGLLAFREIPTVLAALDALPCPPGLIVCDGYGVAHPRRFGLASHLGVLTGLPTIGVAKNPFTFSYEDPGAPRGSAAPLLAGADEVGRALRTQSGVKPVFVSVGHRVDLDHACAHTLALTPKYRIPETTRRADSLCRRALKEATA