xtuition

X000008271

General
NESGVpR162
Spine StatusX-Ray structure
Length111 aa
Mass12.35 kD
ext18450
pI4.89
Name
Putative nitrite reductase NADPH (Small subunit) oxidoreductaseprotein
P NumberP000008289
Database References NCBI UniProt
PFAM PF13806
PDB Structures 3C0D (Xray)
Purification
Date Purified2007-01-16
Setup Date2007-01-26
ExpMolecularWeight13598.9
Volume450.0 ┬ÁL
Concentration9.8 mg/mL
Sequence
Gene
OrganismVibrio parahaemolyticus
GenusVibrio
Speciesparahaemolyticus
Strain
Sequence
MAALTKVKLCQLDDLMPFIGATVLIEGERVALFYIPDSGVYAVQDWDPIGKAYVMSRGIVGDINGEMCVASPLYKQHFSLKSGQCLEDEAHCLKTWRVTVDDNQVCYLAKE