xtuition

X000008273

General
NESGER585
Spine StatusX-Ray structure
Length250 aa
Mass26.95 kD
ext18450
pI6.60
Name
UPF0341 protein yhiQ
P NumberP000008291
Database References NCBI UniProt
PFAM PF04445
PDB Structures 2PGX (Xray)
Purification
Date Purified2007-01-16
Setup Date2007-01-26
ExpMolecularWeight28295.3
Volume450.0 ┬ÁL
Concentration8.1 mg/mL
Sequence
Gene
OrganismEscherichia coli
GenusEscherichia
Speciescoli
Strain
Sequence
MKICLIDETGTGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV