xtuition

X000008303

General
NESGSfR275
Spine StatusX-Ray structure
Length250 aa
Mass26.92 kD
ext18450
pI6.60
Name
UPF0341 protein yhiQ
P NumberP000008323
Database References NCBI UniProt
PFAM PF04445
PDB Structures 2OYR (Xray)
Purification
Date Purified2007-01-24
Setup Date2007-02-02
ExpMolecularWeight28265.3
Volume450.0 ┬ÁL
Concentration0.0 mg/mL
Sequence
Gene
OrganismShigella flexneri
GenusShigella
Speciesflexneri
Strain
Sequence
MKICLIDETGAGDGALSVLAARWGLEHDEDNLMALVLTPEHLELRKRDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASSLTALTDITPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLEPARLLATKRVVVKRPDYAPPLANVATPNAVVTKGHRFDIYAGTPV