xtuition

X000008460

General
NESGStR152
Spine Statuscrystal hits
Length335 aa
Mass37.88 kD
ext28880
pI4.91
Name
Nucleoid-associated protein ndpA
P NumberP000008501
Database References NCBI UniProt
PFAM PF04245
PDB Structures
Purification
Date Purified2007-02-13
Setup Date2007-02-23
ExpMolecularWeight39175.6
Volume450.0 ┬ÁL
Concentration5.8 mg/mL
Sequence
Gene
OrganismSalmonella typhimurium
GenusSalmonella
Speciestyphimurium
Strain
Sequence
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTTTVVEMVAELHRVYSAKNKAYGLFNEESELAQALRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGIVLFCHYRYLAVEYLLVTVLNNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPQSTRYLTFLKGRVGRKVADFFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEIELESLSKELSGVSEVSFSEFTAEKGYELEESFPADRSTLRQLTKYAGSGGGLTINFDAMLLGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK