xtuition

X0000098171500200804240958

X0000098171500200804240958

Well
Read Date2008-04-24 09:58:00
Read NumberX0000098171500200804240958
Week0
Verified Crystal
3-Way Classifier crystal
10-Way Classifier clear
Cocktail8_C1527
ScreenHWI Generation 8
Cocktail: 8_C1527
Name pH Concentration SMILES
Tris 8.5 0.1 M OCC(N)(CO)CO
Potassium sodium tartrate tetrahydrate 8.5 0.6 M [K+].[Na+].O=C([O-])[C@H]…
Sample: X000009817
NESGCfR19
Spine Statusaggregation screening
Length339 aa
Mass37.17 kD
ext18910
pI5.42
Name
Putative molybdopterin biosynthesis protein
Database References NCBI UniProt
PFAM PF00994
PDB Structures 1UZ5 (Best Match)
Sequence
Gene
OrganismClostridium difficile
GenusClostridium
Speciesdifficile
Strain
Sequence
MKLIKTIDAVGQVLCHDITQIIPGEFKGRKFKKGHIVKEEDIPVLLSLGKDNLYVWEKSEGMVHENEGALFLKELTAGENLDFSEIKEGKIDFIAACDGLLKIDVDALFDLNCVGEIMMATLHNNFIVNKGLKVAGTRVIPLVIDEKKLEDAKKVVGNRKIVNVVPFKPKKVGIVTTGNEVFYSRIVDKFGPVIEEKVKGFGCEVIGQTICPDDKEIIKSAIKEFISQGAELICCTGGMSVDPDDVTPTAIKETGADLVTYGSPILPGAMFLLAYYGEVPIMGIPGCAMYHKTTVFDIVLSRVLIDEKLDKYDIARYGHGGLCMNCDVCTYPACNFAKI