X000008840
 | CgR33 |
|---|---|
| Spine Status | aggregation screening |
| Length | 264 aa |
| Mass | 28.04 kD |
| ext | 5500 |
| pI | 4.95 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) |
| P Number | P000008856 |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures |
| Date Purified | 2007-05-07 |
|---|---|
| Setup Date | 2007-05-22 |
| ExpMolecularWeight | 29385.2 |
| Volume | 450.0 µL |
| Concentration | 10.0 mg/mL |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |