X000009225
 | HR3135 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 159 aa |
| Mass | 17.12 kD |
| ext | 12490 |
| pI | 4.26 |
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 gamma;AltName: Full=Cytokine-responsive protein CR6;AltName: Full=DNA-damage-inducible transcript 2; Short=DDIT-2; |
| P Number | P000009270 |
| Database References | NCBI UniProt |
| PFAM | PF01248 |
| PDB Structures | 3FFM (Best Match) |
| Date Purified | 2007-09-04 |
|---|---|
| Setup Date | 2007-09-14 |
| ExpMolecularWeight | 18279.9 |
| Volume | 450.0 µL |
| Concentration | 12.6 mg/mL |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |