X000010077
 | StR222A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 106 aa |
| Mass | 12.60 kD |
| ext | 2980 |
| pI | 9.60 |
| Name | Periplasmic protein related to spheroblast formation |
| P Number | P000010093 |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Date Purified | 2008-06-02 |
|---|---|
| Setup Date | 2008-06-19 |
| ExpMolecularWeight | 14252.7 |
| Volume | 450.0 µL |
| Concentration | 10.8 mg/mL |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |