![]() | CgR122C |
|---|---|
| Spine Status | aggregation screening |
| Length | 219 aa |
| Mass | 23.35 kD |
| ext | 21430 |
| pI | 4.55 |
| Name | Putative nucleoside-diphosphate-sugar epimerase |
| P Number | P000010374 |
| Database References | NCBI UniProt |
| PFAM | PF13460 |
| PDB Structures | 3E8X (Best Match) |
| Date Purified | 2008-08-27 |
|---|---|
| Setup Date | 2008-09-05 |
| ExpMolecularWeight | 24646.5 |
| Volume | 450.0 µL |
| Concentration | 8.7 mg/mL |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MALMTNKTRALLIGGHGKVALLATPMLIDASVQVTSMYRNPDHRSEIEALGATTLERDVTTLSVEDWADLLKDFDVVVWSAGNGGKNGADATYAIDRDAAIASIDGAASLGEKAPRYIMVSYIGSSTHTIDPSASFYPYAESKKAADEHLSSTNLDYLILAPAALTLDEVNGVEVIADTNEAAAGRTTSRVLVAEVITEFVVRDFPQTRVLPFVDGESP |